PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G18770.1
Common NameAtMYB98, F28A21.180, MYB98
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 427aa    MW: 50116.1 Da    PI: 6.5726
Description myb domain protein 98
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G18770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-18217263148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd  l+++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
      AT4G18770.1 217 KGQWTAEEDRVLIQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 263
                      799*****************************.*************97 PP

2Myb_DNA-binding52.11.6e-16269311145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
      AT4G18770.1 269 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 311
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.225212267IPR017930Myb domain
SuperFamilySSF466891.4E-32215310IPR009057Homeodomain-like
SMARTSM007172.8E-17216265IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-27218268IPR009057Homeodomain-like
CDDcd001672.79E-15220263No hitNo description
PfamPF139216.3E-20220277No hitNo description
SMARTSM007174.8E-16268316IPR001005SANT/Myb domain
PROSITE profilePS5129421.16268318IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-22269316IPR009057Homeodomain-like
CDDcd001675.80E-12271314No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000191anatomysynergid
PO:0000282anatomytrichome
PO:0006504anatomyleaf trichome
PO:0009005anatomyroot
PO:0009031anatomysepal
PO:0009089anatomyendosperm
PO:0001052developmental stagevascular leaf expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MENFVDENGF ASLNQNIFTR DQEHMKEEDF PFEVVDQSKP TSFLQDFHHL DHDHQFDHHH  60
HHGSSSSHPL LSVQTTSSCI NNAPFEHCSY QENMVDFYET KPNLMNHHHF QAVENSYFTR  120
NHHHHQEINL VDEHDDPMDL EQNNMMMMRM IPFDYPPTET FKPMNFVMPD EISCVSADND  180
CYRATSFNKT KPFLTRKLSS SSSSSSWKET KKSTLVKGQW TAEEDRVLIQ LVEKYGLRKW  240
SHIAQVLPGR IGKQCRERWH NHLRPDIKKE TWSEEEDRVL IEFHKEIGNK WAEIAKRLPG  300
RTENSIKNHW NATKRRQFSK RKCRSKYPRP SLLQDYIKSL NMGALMASSV PARGRRRESN  360
NKKKDVVVAV EEKKKEEEVY GQDRIVPECV FTDDFGFNEK LLEEGCSIDS LLDDIPQPDI  420
DAFVHGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-4520731848159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-4520731848159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453404000.0
Genevisible254619_at0.0
Expression AtlasAT4G18770-
AtGenExpressAT4G18770-
ATTED-IIAT4G18770-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in cellularized but not uncellularized female gametophytes. {ECO:0000269|PubMed:16214903}.
UniprotTISSUE SPECIFICITY: Expressed at high levels in the synergid cells of the female gametophyte, and at lower levels in the endosperm of young seeds and the trichomes of young leaves and sepals. {ECO:0000269|PubMed:16214903}.
Functional Description ? help Back to Top
Source Description
TAIRMYB98 is a member of the R2R3-MYB gene family, the members of which likely encode transcription factors. Within an ovule, MYB98 is expressed exclusively in the synergid cells, and mutations in this gene affect the female gametophyte specifically. myb98 female gametophytes are affected in two unique features of the synergid cell, pollen tube guidance and the filiform apparatus, but are otherwise normal. This suggests that MYB98 controls the development of specific features within the synergid cell during female gametophyte development. MYB98 also is expressed in trichomes and endosperm. Homozygous myb98 mutants exhibit no sporophytic defects, including trichome and endosperm defects.
UniProtTranscription factor. Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte. Involved in pollen tube guidance to the micropyle. {ECO:0000269|PubMed:16214903}.
Function -- GeneRIF ? help Back to Top
  1. These data suggest that MYB98 functions as a transcriptional regulator in the synergid cells and activates the expression of genes required for pollen tube guidance and filiform apparatus formation.
    [PMID: 17693534]
  2. 11 CRP3700 genes are shown to be regulated by a common cis-element, GTAACNT, and a multimer of this sequence confers MYB98-dependent synergid expression.
    [PMID: 18410484]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G18770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G18770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4468490.0DQ446849.1 Arabidopsis thaliana clone pENTR221-At4g18770 myb family transcription factor (At4g18770) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193612.10.0transcription factor MYB98
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0MF810.0A0MF81_ARATH; Putative uncharacterized protein (Fragment)
STRINGAT4G18770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Kranz H,Scholz K,Weisshaar B
    c-MYB oncogene-like genes encoding three MYB repeats occur in all major plant lineages.
    Plant J., 2000. 21(2): p. 231-5
    [PMID:10743663]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Kasahara RD,Portereiko MF,Sandaklie-Nikolova L,Rabiger DS,Drews GN
    MYB98 is required for pollen tube guidance and synergid cell differentiation in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 2981-92
    [PMID:16214903]
  5. Yu HJ,Hogan P,Sundaresan V
    Analysis of the female gametophyte transcriptome of Arabidopsis by comparative expression profiling.
    Plant Physiol., 2005. 139(4): p. 1853-69
    [PMID:16299181]
  6. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  7. Steffen JG,Kang IH,Macfarlane J,Drews GN
    Identification of genes expressed in the Arabidopsis female gametophyte.
    Plant J., 2007. 51(2): p. 281-92
    [PMID:17559508]
  8. Punwani JA,Rabiger DS,Drews GN
    MYB98 positively regulates a battery of synergid-expressed genes encoding filiform apparatus localized proteins.
    Plant Cell, 2007. 19(8): p. 2557-68
    [PMID:17693534]
  9. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]
  10. Jones-Rhoades MW,Borevitz JO,Preuss D
    Genome-wide expression profiling of the Arabidopsis female gametophyte identifies families of small, secreted proteins.
    PLoS Genet., 2007. 3(10): p. 1848-61
    [PMID:17937500]
  11. Punwani JA,Rabiger DS,Lloyd A,Drews GN
    The MYB98 subcircuit of the synergid gene regulatory network includes genes directly and indirectly regulated by MYB98.
    Plant J., 2008. 55(3): p. 406-14
    [PMID:18410484]
  12. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  13. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  14. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  15. Iwano M, et al.
    Cytoplasmic Ca2+ changes dynamically during the interaction of the pollen tube with synergid cells.
    Development, 2012. 139(22): p. 4202-9
    [PMID:23093426]